Charaka Siddhisthana Chapter 12 - Uttara Basti Siddhi

This article explains the 12th chapter of siddhisthana of Charaka samhita called 'Uttarabasti Siddhi Adhyaya'. In this chapter, "Successful application of excellent recipes for Basti, Post Basti regimen" have been explained. Here, Uttara means great recipes for Basti and does not mean the urethral / vaginal enema therapy.
Read about Uttara Basti: Method, Indications, Mode of Action

???? ????????????????? ??????????????||?|| ??? ? ????? ????????????||?||
athata uttarabastisiddhim vyakhyasyamah||1|| iti ha smaha bhagavanatreyah||2||

We shall now explore the chapter dealing with the "Successful application of excellent recipes for Uttara Basti". Thus said Lord Atreya [1-2]

Table of Contents

Post- therapeutic Management of PatientsPost therapeutic DietRestoration of normal healthAshta Maha Doshakara Bhavas Details off impedimentsComplications of loud and excessive speechComplications of jolting by riding Complications of long distance walking Complications of constant SittingComplications of Indigestion and AdhyasanaComplications of Unwholesome foodComplications of Day-sleepComplications of sexual intercourseManagement of complications caused by loud speech & excessive speechManagement of complications caused by conveyance jolting, etc.Management of complications caused by Indigestion & AdhyasanaManagement of complications caused by irregular meal & unwholesome foodManagement of complications caused by Day sleepManagement of Complications caused by sexual IntercourseMustadya Yapana BastiErandamuladya Yapana BastiSahacharadya Yapana bastiBrihatyadi Yapana BastiBaladya Yapana Basti - First recipeBaladya Yapana Basti - Second recipeHapusadya Yapana BastiLaghupancamuladya Yapana BastiBaladya Yapana Basti - Third RecipeBaladya Yapana basti - Fourth RecipeShaliparnyadya Yapana BastiSthiradi Yapana BastiExtension of Recipe No TwelveTittiradya Yapana BastiDvipanchamuladya Yapani BastiMayuradya Yapana BastiExtension of recipe no. 15Godhadya Yapana BastiKurmadya Yapana Basti and Ten Other Extension RecipesKarkata Rasadya Yapana bastiGo Vrsadya Yapana BastiDashamuladya Yapana BastiExtension of recipe No TwentyMadhvadya Yapana BastiSadyo Ghrtadya Yapana BastiMadhutailadya Yapana bastiMadhughrtadya Yapana basti First RecipeMadhu-Ghrtadya Yapana Basti - Second RecipeSuradya Yapana BastiDvi Panchamuladya Yapana BastiRecipes of Anuvasana BastiBaladya Sneha bastiSahacharadya Sneha BastiAugmenting Potency of Basti RecipesRecapitulationProhibitionsSummaryAugmenting potency of recipesManagement of non-eliminated recipesAdverse effects of excessive use of Yapana basti, and their managementImpediments and their managementDefinition of Siddhi- SthanaMerits achieved by studyPratisamskarta or RedactorDridhabala and his supplementationsTantra Yuktis (Canons of Expositions)Availability of Tantra-YuktisImportance of Tantra-YuktisAssistance of Tantra-Yuktis in understanding other treatisesProper and improper understanding of treatisesMerits of studying this treatiseEpilogueColophon

Post- therapeutic Management of Patients

?? ????????? ?????? ???????? ?????????| ??????? ????????????? ??????????????????||?||
???????????????????????????? ????????| ????????? ????????????????? ??????????||?||
???????? ????? ?????? ????????? ???? ?| ????? ?? ????? ??? ???????????????||?||
atha khalvaturam vaidyah samsuddham vamanadibhih| durbalam krsamalpagnim muktasandhanabandhanam||3||
nirhrtanilavinmutrakaphapittam krsasayam| sunyadeham pratikarasahisnum paripalayet||4||
yatha'ndam tarunam purnam tailapatram yathaiva ca| gopala iva dandi gah sarvasmadapacaratah||5||

Just as we need to handle a fresh egg with tenderness and delicacy, just like we need to handle a brimful oil pot with care, and just like the cattle need to be protected by a cowherd having a staff in his hand, the physician too should protect his patient carefully from the unwholesome (diet, regimen etc.) factors.

This is because after having administered with the purificatory therapies, the body of the patient would undergo certain changes as follows -
o The body of the patient becomes weak and emaciated;
o His digestive power becomes weak
o The ligaments and his joints become loose;
o The (gastro-intestinal tract, bladder and other) viscera become empty (emaciated) because of the elimination of flatus, feces, urine, kapha (phlegm) and Pitta (bile).
o The body becomes empty
o The patient becomes intolerant to adverse situations (like loud speech and other strong therapeutic measures) [3-5]

Post therapeutic Diet

??????????????????? ?? ?????? ???????? ?????| ???????????????? ?????? ??????????||?||
????????????????????????? ??????????? ???| ???????????? ??? ???? ????????? ???||?||
?????????????????????? ?????? ???????????????| ????????????????? ???????? ???????????||?||
agnisandhuksanartham tu purvam peyadina bhisak| rasottarenopacaret kramena kramakovidah||6||
snigdhamlasvaduhrdyani tato'mlalavanau rasau| svadutiktau tato bhuyah kasayakatukau tatah||7||
anyo'nyapratyanikanam rasanam snigdharuksayoh| vyatyasadupayogena prakrtim gamayedbhisak||8||

After the administration of purificatory therapy, the physician who is adept in handling post-therapeutic measures should first of all give to the patient (gradually lighter to heavier) the diet beginning with Peya (thin gruel) and ending with Rasa (meat-soup) for the stimulation of Agni (power of digestion and metabolism).

The patient is given unctuous, soul, sweet and pleasing (Hrudya) food. Then he is given dietetic articles having sour and saline tastes. Later on, he is given foods having sweet and bitter tastes. Thereafter, he is given foods predominant in astringent and pungent tastes.
The patient is given ingredients having mutually contradictory tastes, and mutually contradictory properties like unctuousness and dry alternatively till the normal diet (Prakriti) are restored. [6 -8]
Read: Samsarjana Krama - Graduated Dietetic Protocol After Cleansing Treatments

Restoration of normal health

????????? ?????????? ????????? ??????????????| ?????? ?????????????? ???????? ???????? ???||?||
sarvaksamo hyasamsargo ratiyuktah sthirendriyah| balavan sattvasampanno vijneyah prakrtim gatah||9||

[After the intake of Peya, etc., and ingredients having different tastes as well as attributes], the patient is to be considered as the one having his normal health restored as indicated by the following factors:
o Sarva Kshama - Ability to take and digest various ingredients/foods having all the different tastes.
o Asamsarga - Non-obstruction to his natural urges
o Rati Yukta - Restoration of zest for life
o Sthira Indriya - Sharp functioning of the senses
o Balavan - Return of strength
o Satva Sampanna - Endowment of strong will power [9]

Ashta Maha Doshakara Bhavas

???? ???????????????? ????????????? ????????| ?????????????????????? ?? ???????||??||
????????????? ??????????????????????| ???????????????? ? ??????????? ????????||??||
????? ???????????????????????????????| ?????????? ??????????? ???????? ???????????????||??||
etam prakrtimapraptah sarvavarjyani varjayet| mahadosakaranyastavimani tu visesatah||10||
uccairbhasyam rathaksobhamavicankramanasane| ajirnahitabhojye ca divasvapnam samaithunam||11||
tajja dehordhvasarvadhomadhyapidamadosajah| slesmajah ksayajascaiva vyadhyah syuryathakramam||12||

Till the health is restored with above-mentioned characteristic features (signs), the patient should avoid all the prohibited activities. He should especially avoid eight factors which are exceedingly harmful.
These are as follows:
Avoidable factor and effect of not avoiding
1 Uccaih Bhasya - loud speech causes pain in the upper part of the body
2 Ratha-ksobha - jolts by riding wooden cart (conveyance) causes pain in all over the body
3 Ati-Cankramana - long wayfaring causes pain in the lower part of the body
4 Ati- Asana - constant sitting causes pain in the middle part of the body
5 Ajirna - indigestion gives rise to diseases caused by Ama or uncooked material
6 Ahita-bhojana - intake of unwholesome food gives rise to diseases caused by different Doshas
7 Diva-Svapna - sleep during day time gives rise of diseases caused by kapha
8 Maithuna - sexual intercourse gives rise to diseases caused by Ksaya or diminution of tissue elements [10-20]

Details off impediments

????? ???????? ????????????? ? ??????|
????????????????????? ???????? ????????? ???????||??||
tesam vistarato lingamekaikasya ca bhesajam|
yathavatsampravaksyami siddhan bastimsca yapanan||13||

Now, I (Atreya) shall appropriately explain in detail the signs, treatment and effective Yapana type of Bastis for each of these impediments. [13]

Complications of loud and excessive speech

?????????????????????????????? ??????????????????????????????????? ?????????????????????????????????? ????????????????????????????????????????????????????????????? ????? (?)|
tatroccairbhasyatibhasyabhyam sirastapasankhakarnanistodasrotroparodha mukhatalukanthasosataimiryapipasajvaratamaka hanugrahamanyastambhanisthivanorahparsvasulasvarabhedahikkasvasadayah syuh (1)|

Speaking loudly or speaking in excess [before the restoration of health, after the purificatory therapy] gives rise to complications as follows:
o Shiras Tapa - Burning sensation in the head
o Shankha, Karna Nistoda - Pricking pain in the temples and ears
o Shrotra Uparodha - Auditory dysfunction (deafness)
o Mukha, Talu, Kantha Shosha - Dryness of mouth, palates and throat
o Timira - Fainting, black outs
o Pipasa, Jwara, Tamaka - Thirst, fever, Tamaka (a feeling as if entering into darkness), spasticity of jaws (Hanugraha),
Manyastmabha - torticollis and
Nishteevana - ptyalism;
o Ura Parshva Shoola - Pain in the chest and sides of the chest
o Svara Bheda - Hoarseness of voice
o Hikka Shwasa - Hiccup and asthma and Such other complications [14 (1)]

Complications of jolting by riding

?????????? ?????????????????????????????????????????????????????????????????????????????????????- ??????????????????????????????????????????????????????????????????????????????????????????????? (?)|
rathaksobhat sandhiparvasaithilyahanunasakarnasirahsulatodakuksiksobhatopantrakujanadhmanahrdayendriyoparodha- sphikparsvavanksanavrsanakatiprsthavedanasandhiskandhagrivadaurbalyangabhitapapadasophaprasvapaharsanadayah (2)|

Jolting caused by riding conveyance soon after Shodhana therapy gives rise to complications as follows:
Sandhi Parva Shaithilya - Looseness of big and small joints
Hanu, nasa, Karna, Shirashoola Toda - Colic and pricking pain in jaws, nose, ears and head
Kukshi Kshobha - Irritation in the pelvic region, meteorism,
Atopa, Antra Kujana, Adhmana - gurgling noise in intestines and flatulence;
Hrudaya Indriya Uparodha - Obstruction in the functioning of the heart and sense organs,
Sphik, Parshva, Vankshana Vrushana Kati Prishta Vedana - Pain in the hips, sides of the chest, groin, scrotum, waist and back
Sandhi Skandha Greeva Daurbalya - Weakness of joints, shoulders and neck
Anga Abhitapa - Burning sensation in limbs
Pada Shopha, Prasvapa, Harshana - Oedema, numbness and tingling sensation in feet and
Such other complications 14

Complications of long distance walking

?????????????? ??????????????????????????????????????????????????- ????????????????????????????????????????????????????????? (?)|
aticankramanat padajanghorujanuvanksanasroniprsthasulasakthisadanistoda- pindikodvestanangamardamsabhitapasiradhamaniharsasvasakasadayah (3)|

Long wayfaring [soon after the purificatory therapy] gives rise to complications as follows:
Pain in the feet, calf region, thighs, knees, groin, waist and back
Asthenia and pricking pain in legs (Sakthi)
Cramps in the calf region
Malaise
Burning sensation in the shoulders
Swelling of the veins and arteries
Asthma and cough and
Such other complications [14 (3)]

Complications of constant Sitting

???????????????????? ???????????????????????????????????????? (?)|
atyasanadrathaksobhajah sphikparsvavanksanavrsanakatiprsthavedanadayah (4)|

Constant sitting [before the restoration of health after shodhana] gives rise to complications like pain in the hips, sides of the chest, groins, scrotum, waist and back which are described earlier in respect of jolting by conveyance, and such other complications. [14 (4)]

Complications of Indigestion and Adhyasana

?????????????????? ?? ?????????????????????????????????????????????????????????????????????????????(?)|
ajirnadhyasanabhyam tu mukhasosadhmanasulanistodapipasagatrasadacchardyatisaramurcchajvarapravahanamavisadayah(5)|

Indigestion and Adhyasana (intake of food before the previous meal is digested) [before the restoration of normal of normal health of after purificatory therapy] give rise to following complications:
Dryness of the mouth, flatulence, colic pain and pricking pain
Thirst, prostration of the body, vomiting, diarrhoea, fainting, fever and gripping pain
Ama Visha or poisoning effect caused by Ama (product of indigestion) and
Such other complications [14 (5)]

Complications of Unwholesome food

????????????????????????????????????????????????????????????????????????????? ???????????????????? (?)|
visamahitasanabhyamanannabhilasadaurbalyavaivarnyakandupamagatrasadavatadiprakopajasca grahanyarsovikaradayah (6)|

Intake of irregular meals and unwholesome food [before the restoration of normal health after purificatory therapy] produces complications as follows:
Lack of desire for taking food
Weakness, discoloration of the skin, itching, scabies and prostration of the body; and
Sprue, piles and such other diseases caused by the aggravation of vayu. [14 (6)]

Complications of Day-sleep

???????????????????????????????????????????????????????????????????????????????????????????????????????- ??????????????????????????????????????????????????? (?)|
divasvapnadarocakavipakagninasastaimityapandutvakandupamadahacchardyangamardahrtstambhajadyatandranidra- prasangagranthijanmadaurbalyaraktamutraksitatalulepah (7)|

Sleep during the day time [before the restoration of normal health after purificatory therapy] produces complications as follows:
Anorexia, indigestion and suppression of the power of digestion
Staimitya (feeling as if the body is covered with wet leather)
Anaemia, itching, scabies, burning sensation, vomiting and malaise
Impairment of the cardiac functions, stiffness, drowsiness and continuous sleep
Appearance of nodules
Weakness
Reddish coloration of urine and eyes and
Coating over the palate [14 (7)]

Complications of sexual intercourse

??????????????????????????????????????????????????????????????????????????????????????????????- ??????????????????????????????????????????????????????????????????????????????????????- ?????????????????????????????????????????????????????? ?????; ???????? ?? ????, ?????? ?? ???????, ???????? ???, ????? ?????, ????????? ??????, ??? ????????? ?? ? (?)|
vyavayadasubalanasorusadasirobastigudamedhravanksanorujanujanghapadasulahrdayaspandananetrapidangasaithilya- sukramargasonitagamanakasasvasasonitasthivanasvaravasadakatidaurbalyaikangasarvangarogamuskasvayathu- vatavarcomutrasangasukravisargajadyavepathubadhiryavisadadayah syuh; avalupyata iva gudah, tadyata iva medhram, avasidativa mano, vepate hrdayam, pidyante sandhayah, tamah pravesyata iva ca (8)|

Sexual intercourse [before the restoration of health after shodhana] produces complications as follows;
Instantaneous loss of strength, Prostration of thighs, Colicky pain in the head, region of urinary bladder, anus, phallus, groins, thighs, knees, calf regions and feet, Palpitation of heart, Pain in the eyes, Asthenia of the limbs , Bleeding through the seminal passage, Cough, asthma, haemoptysis and asthenia of the voice;
Weakness of lumbar region, Paralysis of the part of the body or the whole body, Oedema in the scrotum, Retention of flatus, stool and urine, Excessive discharge of semen, Numbness, trembling, deafness and Vishada (depression), A feeling as if the anus is being cut, Pain in the phallus as if it is being cut, A feeling as if the mind is shrinking, Trembling of the heart,Pain in joints hearts
A feeling as if entering into darkness [14- (8)]

?????????????????????????? ???????????????????????||??||
ityevamebhirastabhirapacarairete pradurbhavantyupadravah||14||

Thus, the above-mentioned complications arise because of the eight types of impediments [described in the verse no. 11] [14]

Management of complications caused by loud speech & excessive speech

????? ???????- ?????????????????????????????????????????????????????????????????????????????????????? ????? ?????????? ? (?)|
tesam siddhih- tatroccairbhasyatibhasyajanamabhyangasvedopanahadhumanasyoparibhaktasnehapanarasaksiradirvataharah sarvo vidhirmaunam ca (1)|

Now the successful treatment of these complications [arising out of impediments during the period of convalescence] will be discussed.
Complications caused by loud speech and excessive speech can be cured by all the alleviating measures including the following:
Massage and fomentation therapies
Upanaha (application of hot poultices)
Dhuma (smoking therapy)
Nasya (inhalation therapy)
Upari-Bhakta sneha-pana (intake of medicated ghee after the meal)
Intake of meat soup, milk etc., and
Observation of silence [15 (1)]

Management of complications caused by conveyance jolting, etc.

?????????????????????????????? ??????????????????? ???? ????? ??????????? ? (?)|
rathaksobhaticankramanatyasanajanam snehasvedadivataharam karma sarvam nidanavarjanam ca (2)|

Complications because of jolting by conveyance, long wayfaring and excessive sitting can be cured by all vayu alleviating therapies like oleation, fomentation, etc., the patient should avoid the causative factors. [15 (2)]

Management of complications caused by Indigestion & Adhyasana

????????????????? ???????????????? ?????? ?????? ????????????????????????????? ? (?)|
ajirnadhyasanajanam niravasesataschardanam ruksah svedo langhaniyapacaniyadipaniyausadhavacaranam ca (3)|

Complications arising out of indigestion and adhyasana (taking food before the previous meal is digested) can be cured by the following:
Administration of emetic therapy in order to completely take out the undigested material [from the stomach]
Ruksa sveda (dry fomentation) and
Administration of medications which are Langhaniya (producing lightening effect on the body), Pachaniya (carminative) and Dipaniya (digestive stimulant) [15 (3)]

Management of complications caused by irregular meal & unwholesome food

???????????????? ??????? ??????? ??????? (?)|
visamahitasanajanam yathasvam dosaharah kriyah (4)|

Complications arising out of irregular and intake of unwholesome food can be cured by appropriate therapies for the alleviation of respective Doshas which are aggravated. [15 (4)]

Management of complications caused by Day sleep

??????????????? ???????????????????????????????????????????????????????????? ????????????????????????????? ?????????? ????? ????? (?)|
divasvapnajanam dhumapanalanghanavamanasirovirecanavyayamaruksasanaristadipaniyausadhopayogah pragharsanonmardanaparisecanadisca slesmaharah sarvo vidhih (5)|

Complications arising out of day sleep can be cured by all the Kapha- alleviating measures including the following:
Dhuma-Pana (smoking)
Langhana (fasting or lightening therapy)
Vamana (emetic therapy)
Shiro- virechana (therapy for the elimination of morbid matter from the head)
Vyayama (physical exercise)
Ruksa Ashana (intake of ununctuous food)
Arista (intake of alcoholic preparations)
Administration of drugs which are dipaniya (digestive stimulant) and
Pragharsana (friction massage), unmardana (kneading the body) and Parisecana (hot affusion) etc.,

Management of Complications caused by sexual Intercourse

?????????? ?????????????? ???????????????????, ??? ??????? ?????????????????? ??????????????? ??????? ?????????? ??????????????????? ?; ????????????????????? ??????????????????????????????????????????????? ???? ??????||??||
maithunajanam jivaniyasiddhayoh ksirasarpisorupayogah, tatha vataharah svedabhyangopanaha vrsyascaharah snehah snehavidhayo yapanabastayo'nuvasanam ca; mutravaikrtabastisulesu cottarabastirvidarigandhadiganajivaniyaksirasamsiddham tailam syat||15||

Complications caused by sexual intercourse can be cured by the following:
Administration of milk and ghee cooked by adding drugs belonging to Jivaniya- group of herbs (Jivaka, Rsabhaka, Meda, Mahameda, Kokoli, Ksirakakoli, Mudgaparni, Mashaparni, Jivanti and Madhuka- Vide Sutra 4: 9:1)
Administration of fomentation, massage and upanaha (application of hot poultice) which are best in alleviating vata
Intake of food which promotes virility
Intake of unctuous foods and application of unctuous therapies:
Yapana and Anuvasana types of medicated enema and
If there are urinary morbidities, and pain in the region of urinary bladder, then Uttara-Basti is given with oil cooked by adding milk boiled with Vidarigandhadi and Jivaniya Gana groups of drugs. [15]

Mustadya Yapana Basti

???????? ?????? ???????? ?????; ???????????????- ???????????????????????????????????????????????????????????????????????????????????????? ??????? ?????? ??????????????? ? ???????? ?????????? ?????? ?????????? ??????? ??? ??????????????????????? ???? ???? ??????????? ????????????????????????? ??????????????????????????????????????????? ???????? ???????? ?????? ??????????????? ??????????????????????????????????(??????)- ?????????????????????????????????????????????????????????????????- ?????????????????????????????????????????????????????????????????????????????? ????? ?????? ??????????? (?)|
yapanasca bastayah sarvakalam deyah; tanupadeksyamah- mustosirabalaragvadharasnamanjisthakaturohinitrayamanapunarnavabibhitakaguducisthiradipancamulani palikani khandasah klrptanyastau ca madanaphalani praksalya jaladhake parikvathya padaseso rasah ksiradviprasthasamyuktah punah srtah ksiravasesah padajangalarasastulyamadhughrtah satakusumamadhukakutajaphalarasanjanapriyangukalkikrtah sasaindhavah sukhosno bastih sukramamsabalajananah ksataksinakasagulmasulavisamajvarabradhna(vardhma)- kundalodavartakuksisulamutrakrcchrasrgrajovisarpapravahikasiroruja- janurujanghabastigrahasmaryunmadarsahpramehadhmanavataraktapittaslesmavyadhiharah sadyo balajanano rasayanasceti (1)|

Yapana type of Basti (medicated enema for the promotion of longevity) can be administered at all times. The recipes for this type of medicated enema will be described hereafter.
One Pala each of Musta, Usira, Bala, Aragvadha, Rasna, Manjistha, Katurohini, Trayamana, Punarnava, Bibhitaka, Guduchi, Shalaparni, Brhati, Kantakari and Gokshura are cut into small pieces. To this, eight fruits of madana are added. The whole recipe should then be washed well and cooked by adding one adhaka (25 Tolas) of water till one fourth of water remains. To this decoction, two prasthas (128 Tolas) of cow's milk is added and boiled again till two prasthas of the liquid remains. To this liquid, half prastha of the soup of the meat of animals inhabiting desert like zone, ghee taken in quantity equal to honey (as prescribed in earlier enema- recipes) and the paste of Shatakusuma (Shatapuspa), Madhuka, fruit of kutaja, rasanjana, Priyangu as well as a little of saindhava (rock-salt) is added. This recipe, when luke-warm, is used for enema.
This medicated enema has the following therapeutic effects -
It promotes semen, muscle, tissue and strength
It cures Kshata-ksina (consumption), cough, Gulma (phantom tumour), colic pain, irregular fever, Bradhna or vardhana (inguinal swelling), Kundala (circular movement of wind), Udavarta (upward movements of wind in the abdomen), pain in the pelvic region, dysuria, Asrg-rajah (menorrhagia), Visarpa (erysipelas), Pravahika (dysentery) and headache.
It cures stiffness of knee joints, thighs, calf regions and the region of urinary bladder.
It cures asmari, insanity, piles, prameha, flatulence, vatarakta (gout) and diseases caused by aggravated pitta as well as kapha.
It instantaneously promotes strength and
It rejuvenates the body [16 (1)]
Read: Basti Chikitsa: Benefits, Routes, Types, Indications, Equipment

Erandamuladya Yapana Basti

??????????????? ?????? ???????????????????? ????? ?????????? ????????? ??????????????? ?????? ??????????????? ??????????? ??????? ?????? ?????????? ????? ?????? ?????????? ?????? ????????? ?????|
??????? ????? ???? ????????????????????????????????????????????????????????????????????????????????? ????????????????????? ???????? ????????? ???? ?????? ?? ???????|
???????? ???????? ??????? ?????????????????????????????????????????????????????????? ? (?)|
erandamulapalasat satpalam saliparniprsniparni brhati kantakarika goksurako rasna'svagandha guduci varsabhuraragvadho devadarviti palikani khandasah klrptani phalani castau praksalya jaladhake ksirapade pacet|
padasesam kasayam putam satakusumakusthamustapippalihapusabilvavacavatsakaphalarasanjanapriyanguyavanipraksepakalkitam madhughrtatailasaindhavayuktam sukhosnam niruhamekam dvau trin va dadyat|
sarvesam prasasto visesato lalitasukumarastriviharaksinaksatasthaviracirarsasamapatyakamanam ca (2)|

Six Palas of the root and leaves of Eranda and one Pala each of Shalaparni, Prsniparni, Brhati, Kantakari, Gokshura, Rasna, Ashvagandha, Guduchi, Varsabhu (punarnava), Aragvadha and Devadaru is cut into pieces, washed well and cooked by adding one adhaka of water and one fourh adhaka of milk till one fourth of the liquid remains. To this decoction, the paste of Shata-Kusuma (Shatapuspa), Kustha, Musta, Pippali, Hapusa, Bilva, Vacha, fruit of Vatsaka, Rasanjana, Priyangu and Yavani is added. By adding honey, ghee, oil and rock- salt, this recipe, when luke-warm, is given in the form of Niruha (evacuative) once, twice or three times.
This medicated enema is useful for all, especially for the following types of persons:
Pleasure- loving people
Those having tender health
Those indulging excessively in sex
Emaciated persons and those suffering from phthisis
Old persons
Persons suffering from chronic piles and
Persons desirous of progeny [16(2)]

Sahacharadya Yapana basti

?????? ???? ??? ??????? ?????? ??????? ???? (?) |
tadvat sahacara bala darbhamula sariva siddhena payasa (3) |

Following the above-mentioned procedure, enema recipe can be prepared of milk boiled with Sahachara, Bala, root of Darbha and Sariva. [16 (3)]

Brihatyadi Yapana Basti

??? ????? ???????? ?????? ???????????????? ???? ???? ??? ??????????????? ?????????????? (?) |
tatha brhati kantakari satavari cchinnaruhasrtena payasa madhuka madana pippalikalkitena purvavadvastih (4) |

Milk is boiled by adding Brihati, Kantakari, Shatavari and Chinnaruha. To this milk, the paste of Madhuka, Madana and Pippali is added. Following the above-mentioned procedure (described in Para 16-2) enema of this recipe is given. [16 (4)]

Baladya Yapana Basti - First recipe

??? ???????? ?????? ????????? ??????????? ????? ?????????? ??????? ????? ???????? ??????? ?? ??????? ???? ???? ??? ???????? ??? ??? ?????????????? ??? ???? ????? ???????????????????????????????? ??????????? ???????? (?)|
tatha balatibala vidari saliparni prsniparni brhati kantakarika darbhamula parusaka kasmarya bilvaphala yava siddhena payasa madhuka madana kalkitena madhu ghrta sauvarcalayuktena kasa jvara gulma pliharditastrimadyaklistanam sadyobalajanano rasayanasca (5)|

Milk boiled with bala, Vidari, Shaliparni, Prsniparni, Brhati, kantakarika, root of Darbha, Parusaka, Kashmarya, fruit of Bilva and Yava is added with the paste of madhuka and Madana along with honey, ghee as well as sauvarcala.
Enema with this recipe instantaneously promotes strength, and rejuvenates the body of persons suffering from cough, fever, gulma (phantom tumour), pliha (splenic disorders) and ardita (facial paralysis). This recipe also instantaneously promotes strength, and rejuvenates the body of persons who are afflicted with excessive sexual indulgence and alcoholism. [16 (5)]

Baladya Yapana Basti - Second recipe

???????? ??????????? ??? ????? ?????? ????????????????????? ???? ???? ??????? ?????????????? ??????? ?? ????????? ??????????? ????????????? ? ????????????? ????? ???????????? ????? ???? ???? ??? ???????? ????? ??????? ??? ??????? ??????? ????????? ????? ????????? ??? ??? ??? ???????????????? ?????? ??????? ???????????? ???????? ?????? ????????????????????????????????? ????? ????????????? ?????? ??????? ????? ??????? ?????????? ????????? ? (?)|
balatibala rasnaragvadha madana bilva guduci punarnavairandasvagandha sahacara palasa devadaru dvipancamulani palikani yava kolakulattha dviprasrtam suskamulakanam ca jaladronasiddham niruha pramanavasesam kasayam putam madhuka madana satapuspa kustha pippali vaca vatsakaphala rasanjana priyangu yavani kalkikrtam guda ghrta taila ksaudraksiramamsa rasamla kanjika saindhavayuktam sukhosnam bastim dadyacchukramutravarcahsange'nilaje gulma hrdrogadhmana bradhna parsva prstha katigraha sanjnanasa balaksayesu ca (6)|

One Pala each of Bala, Atibala, Rasna, Aragvadha, Madana, Bilva (fruit), Guduchi, Punarnava, Eranda, Ashwagandha, Sahacara, Palasa, Devadaru, Bilva (root), Shyonaka, Gambhari Patala, Ganikarika, Shalaparni, Prsniparni, Brihati, Kantakari, and Gokusura, and two prasta each of Yava, Kola, Kulattha as well as Suska Mulaka is boiled by adding one drona of water till five Prasthas (vide commentary) of liquid remains. To this strained decoction the paste of Madhuka, Madana, Shatapuspa, Kustha, Pippali, Vacha, fruit of Vatsaka, Rasanjana, Priyangu and Yavani is added. By adding Jaggery, ghee, oil, honey, milk, meat soup, sour vinegar (amla Kanjika) and Saindhava. This recipe, when lukewarm, is used for enema.
This enema cures the following ailments:
Retention of semen, urine and stool caused by the aggravated vayu and
Gulma (phantom tumour),
hrdroga (heart diseases),
flatulence,
Bradhna (inguinal swellings),
stiffness of the sides of the chest, back and lumbar region,
unconsciousness and
diminution of strength [16 (6)]

Hapusadya Yapana Basti

????????????? ????????????????????? ???????? ?????? ????????? ??? ??? ??? ????????? ???????? ????? ??????? ???? ???????????????????????? ?????? ?????? ???????? ?? ?????? (?)|
hapusardhakudavo dvigunardhaksunnayavah ksirodaka siddhah ksiraseso madhu ghrta taila lavanayuktah sarvanga visrta vatarakta sakta vinmutrastrikheditahito vataharo buddhi medhagni bala jananasca (7)|

Half Kuduva of Hapusa and one Kudava of half crushed grains of Yava is boiled by adding water and milk till the quantity left over is equal to the quantity of milk. This is added with honey, ghee, oil and rock-salt [and administration for enema].
This medicated enema has the following effects
It cures Vatarakta (gout) afflicting the entire body
It cures retention of stool and urine
It cures ailments caused by excessive sexual intercourse with women;
It alleviates vayu and
It promotes wisdom, intellect, Agni, (power of digestion and metabolism) and strength. [16 (7)]

Laghupancamuladya Yapana Basti

?????? ???? ???? ????? ???????? ?????? ??????? ???? ??? ????????? ???? ??? ??? ???? ????? ???????? ????????? ?????? (?) |
hrasva panca muli kasayah ksirodaka siddhah pippali madhuka madana kalkikrtah saguda ghrta taila lavanah ksina visamajvara karsitasya bastih (8) |

Decoction of Laghupancamula (Shalaparni, Prsniparni, Brhati, Kantakari and Gokshura) prepared by boiling with milk and water is added with the paste of Pippali, Madhuka and Madana. Added with jaggery, ghee, oil and rock-salt, this recipe is administered as enema.
Enema with this recipe is useful for consumption and for persons emaciated because of Vishama-Jvara (irregular fever). [16 (8)]

Baladya Yapana Basti - Third Recipe

?????????????????????????????????? ??????? ???????? ????? ???? ??? ??? ????????? ???????????????????? ?????? ????? ????? ????????? ??????? (?)|
balatibalapamargatmaguptastapalardha ksunna yavanjali kasayah saguda ghrta taila lavanayuktah purvavadbastihsthavira durbala ksina sukra rudhiranam pathyatamah (9)|

Eight Palas of Bala, Atibala, Apamarga and Atmagupta, and one anjali of half crushed barley are made into a decoction [by boiling with milk and water]. To this decoction, jaggery, ghee, oil and rock-salt is added, and used for enema as before. This enema is exceedingly wholesome for old and weak persons, and for persons having diminished semen and blood. [16 (9)]

Baladya Yapana basti - Fourth Recipe

??? ???? ?????? ??????? ???????? ???? ????????? ???? ??????? ???? ??? ??????? ???? ??? ??????? ????????????? ?????? ??????? (??) |
bala madhuka vidari darbhamula mrdvika yavaih kasayamajena payasa paktva madhuka madana kalkitam samadhu ghrta saindhavam jvarartebhyo bastim dadyat (10) |

The decoction of Bala, madhuka, Vidari, root of Darbha, Mrdvika and Yava is boiled by adding goat's milk. This decoction is mixed with the paste of Madhuka and madana. This recipe is added with honey, ghee and rock-salt.
Enema with this recipe is useful for persons suffering from fever. [16 (10)]

Shaliparnyadya Yapana Basti

????????? ??????????? ???????? ??? ???????? ????? ???????? ?????????????????? ?? ???????????? ?????? ????? ??????? ???????????????? ???? ??????? ????????????? ???????? ????????? ?????? ????? (??) |
saliparni prsniparni goksuraka mula kasmarya parusaka kharjuraphala madhukapuspairajaksira jala prasthabhyam siddhah kasayah pippali madhukotpalakalkitah saghrta saindhavah ksinendriya visamajvara karsitasya bastih sastah (11) |

Roots of Shaliparni, Prsniparni and Gokshura, Kashmarya, Parusaka, fruits of Kharjura and flowers of madhuka are added with one prastha each of goat's milk and water, and cooked. In this decoction, the paste of Pippali, Madhuka and Utpala is mixed. Added with ghee and rock-salt, this recipe is used as enema.
This medicated enema is useful for weakened sense faculties and emaciation caused by Vishama Jvara (Irregular fever). [16 (11)]

Sthiradi Yapana Basti

???????? ???????????????? ???? ?????? ?? ????? ??? ???????????? ???? ??? ???? ??????? ??????????? ?? ?? ??? ??? ?????? ?????? ??????? ?????? ??????????????? ???????????? |
??? ????? ?????? ??????||??||
sthiradi pancamulipancapalena sali sastika yava godhuma masa pancaprasrtena chagam payah srtam padasesam kukkutanda rasa sama madhu ghrta sarkara saindhava sauvarcala yukto vastirvrsyatamo balavarnajananasca |
iti yapana bastayo dvadasa||16||

Five Palas of Sthiradi Panchamula (Shalaparni, Prsniparni, Brhati, Kantakari and Gokshura), and five Prasrtas of Shali, Shashtika, Yava, Godhuma and Masha are boiled by adding goat's milk and reduced to one-fourth. In this decoction equal quantity of the sap of hen's egg is mixed. By adding honey, ghee, sugar, rock-salt and Sauvarcala to this recipe, enema is given.
This medicated enema is exceedingly aphrodisiac, and it promotes strength as well as complexion.
Thus, ends the description of twelve recipes for Yapana type of basti (medicated enema for promotion of longevity). [16]

Extension of Recipe No Twelve

????????? ???? ?????? ??? ???????? ????? ??????||??||
kalpascaisa sikhi gonarda hamsa sarasanda rasesu syat||17||

The above-mentioned enema recipe can also be prepared by substituting the sap of hen's egg with that of the eggs of Sikhi (pea-hen), Gonarda (hill-partridge), Hamsa (swan) or Sarasa (crane). [17]

Tittiradya Yapana Basti

?????????? ?????? ???????? ???????? ??? ?????? ???????? ???? ?????? ???? ????? ??????? ????? ??? ??? ??? ?????? ?????? ????? ???? ???? ????? ???? ???????? (?) |
satittirih samayurah sarajahamsah pancamuli payah siddhah satapuspa madhuka rasna kutaja madanaphala pippali kalko ghrta taila guda saindhava yukto basti rbala varna sukra janano rasayanasca (1) |

Pancha mula (Shalaparni, Prsniparni, Brhati, Kantakari and Gokshura) is boiled with milk. To this milk, soup of the meat of Tittiri, Mayura and rajahamsa, and the paste of Shatapuspa, madhuka, rasna, Kutaja, madanaphala and Pippali is added. This recipe is mixed with ghee, oil, jaggery and rock-salt and used for enema.
Enema with this recipe promotes strength complexion and semen. This rejuvenates the body. [18 (1)]

Dvipanchamuladya Yapani Basti

???????????? ??????? ?? ?????? ??? ??????? ??????? ???? ?????? ??? ????? ?????? ??? ????????? ?????????????????? ?????? ?????? (?) |
Dvipanchamuladya Yapani Basti
dvipancamuli kukkuta rasa siddham payah padasesam pippali madhuka rasna madana kalkam sarkara madhu ghrtayuktam strisvatikamanam balajanano bastih (2) |

Drugs belonging to two types of DwiPanchamula (Dashamoola) and chicken soup are boiled by adding milk till one fourth of the liquid remains. To this liquid, the paste of Pippali, madhuka, rasna and madana is added. By adding sugar, honey and ghee, this recipe is used for enema.
Enema with this recipe promotes the strength of the persons who are addicted to excessive sexual indulgence. [18 (2)]

Mayuradya Yapana Basti

???????????????????????????? ??????????? ?????? ???? ???? ??????? ????????? ??? ??????? ?????? ???????? ???? ????????? ??? ??? ?????? ?????? ?????? ??????? ??????????? ??????? ?????????????????? ?????????? (?) |
mayuramapittapaksapadasyantram sthiradibhih palikaih sajale payasi paktva ksirasesam madana pippali vidari satakusuma madhuka kalkikrtam madhu ghrta saindhava yuktam bastim dadyat strisvati prasakta ksinendriyebhyo balavarnakaram (3) |

The gall-bladder, feather, legs, beak and intestines of the peacock are removed. The meat of this peacock is added with one pala each of Shalaparni, Prsniparni, Brhati, Kantakari and Gokshura, and cooked by adding water and milk till the remaining liquid is equal to the quantity of milk. To this liquid, the paste of Madana, Pippali, Vidari, Shata-Kusuma (Shatapushpa) and Madhuka is added. By further adding honey, ghee and rock-salt, this recipe is used for enema.
Enema with this recipe promotes the strength and complexion of persons who have diminished functioning of their sensory faculties and motor organs because of over indulgence in sex. [18 (3)]

Extension of recipe no. 15

????????? ??????? ?????? ??????????????? ??????, ??????? ?????????? ? ????????? (?) |
kalpascaisa viskira pratuda prasahambucaresu syat, aksiro rohitadisu ca matsyesu (4) |

The above-mentioned enema - recipe can be prepared by substituting peacock - meat with meat of animals and birds of the following categories:
Viskira (Gallinaceous brids)
Pratuda (pecker birds)
Prasaha (animals and birds who eat by snatching their food) and
Vaicara (birds moving in the water)
Similarly, different types of fish like Rohiita can be used in place of the meat of peacock. But while preparing enema recipes with fish, milk should not be added. [18 (4)]

Godhadya Yapana Basti

???????? ??????? ????? ????? ???????? ??????? ?????? ??????????? ???? ??????? ??????????????? ???? ?????? ??????? ?????? ??? ??? ??? ?????? ???????????? ?????? ???????????? ????????? ??????????? ?? ?? ???? ???????? ??????????????? ???????????? ????????????? ???????? (?)|
godhanakula marjara musika sallaka mamsanam dasapalan bhagan sapancamulan payasi paktva tatpayahpippaliphala kalka saindhava sauvarcala sarkara madhu ghrta taila yukto bastirbalyo rasayanah ksinaksatasya sandhanakaro mathitoraskaratha gaja haya bhagna vatabalasaka prabhrtyudavarta vatasaktamutra varcassukanam hitatamasca (5)|

Drugs belonging to the group of Panchamula (Bilva, Syonaka, Gambhari, Patala and Ganikarika) and ten palas of the meat of iguana (godha), mongoose (nakula), cat (marjara) and mouse (musika) are cooked by adding milk. To this liquid (containing milk), the paste of pippali and Phala (Madanaphala) should be added. This should further be added with rock-salt, Sauvarcala, sugar, honey, ghee and oil, and used for enema.
Enema with this recipe is exceedingly useful for the following:
Promotion of strength
Rejuvenation of the body
Healing the phthisis lesion
Curing ailments caused by the compression of the chest
Correcting fractures caused by riding ratha (wooden cart) elephant and horse
Curing vata-balasaka (an ailment caused by the simultaneous aggravation of vayu and kapha) and such other diseases and
Curing Udavarta (upward movement of wind in the abdomen) and retention of urine, stool as well as semen caused by the aggravation of vayu. [18 (5)

Kurmadya Yapana Basti and Ten Other Extension Recipes

???????????????? ????? ?????? ??? ?? ???????????? ??? ????????????? ??? ??? ?????? ????????????????????????? ???? ???????? ????? ????????????? ?????? (?) |
Kurmadya Yapana Basti and Ten Other Extension Recipes
kurmadinamanyatama pisita siddham payo go vrsanagahayanakra hamsa kukkutandarasa madhu ghrta sarkara saindhaveksurakatmaguptaphala kalka samsrsto basti rvrddhanamapi balajananah (6) |

The meat of any Kurma (tortoise) group of aquatic animals, is boiled with milk. This milk should be added with the soup of the testicles of bull, elephant and horse, the sap of the eggs of crocodile, swan and hen, honey, ghee, sugar and rock-salt. To this, the paste of Iksuraka as well as the fruit of atmagupta is added, and used for enema.
Enema with these recipes promotes strength even in old people. [18 (6)]

Karkata Rasadya Yapana basti

??????????????????????????? ??? ??????????????????????????????????????????????????????????????????????????????? ?????????????????? ?????? (?) |
kurmadinamanyatamapisitasiddham payo govrsanagahayanakrahamsakukkutandarasamadhughrtasarkarasaindhaveksurakatmaguptaphalakalkasamsrsto bastirvrddhanamapi balajananah (6) |

Soup of the meat of Karkataka (crab) added with the sap of the egg of Cataka, honey, ghee and sugar is used as enema.
Enema with these recipes is exceedingly aphrodisiac. If milk boiled with Uccataka, Iksuraka, Kokilaksa and Atmagupta is taken after the administration of these enemas, then the person becomes capable of having sexual intercourse with many (lit hundred) women. [18 (7)]

Go Vrsadya Yapana Basti

????? ???? ???? ???? ????? ??? ?????? ????????????????????????????? ??? ??? ?????? ?????? ?????????????? ?????? (?) |
govrsa basta varaha vrsana karkata cataka siddham ksiramuccatakeksurakatmagupta madhu ghrta saindhava yuktah kincillavanito bastih (8) |

Milk boiled with the testicles of Go-Vrsa (bull), goat and Pig, Karkataka and Cataka is added with the paste of Uccata, Iksuaka (Kokilaksa) and Atmagupta, honey, ghee, rock-salt and small quantity of sea-salt and used for enema.
Enema with this recipe is exceedingly aphrodisiac and it enables a person to indulge in sex with many women. [18 (8)]

Dashamuladya Yapana Basti

????? ???? ??? ??????? ???????? ??????????? ??? ??? ??? ???? ????????????????? ???????? ????? ????? ????????? ????? ?????? ??? ???????????? ????? ????? ??????? ????? ???????? ?????? (?)|
dasamula mayura hamsa kukkuta kvathat pancaprasrtam taila ghrta vasa majja catusprasrtayuktam satapuspa musta hapusa kalkikrtah salavano bastih pada gulphorujanu jangha trika vanksana basti vrsananila rogaharah (9)|

To five Prasthas of the decoction of Dashamula and meat of peacock, swan as well as domestic fowl, four prasrtas of oil, ghee, vasa (muscle-fat) and majja (bone marrow) is added. This liquid is added with the paste of Shatapuspa, Musta and Hapusa. By adding salt (rock-salt) this recipe is used for enema.
This enema cures Vatika diseases afflicting feet, ankle joints, thighs, knee-joints, calf region, lumbar region, groins, urinary bladder region and testicles. [18 (9)]

Extension of recipe No Twenty

??? ??????????? ???????????????? ?????? ?????? ????? (??) |
mrga viskiranupa bilesayanametenaiva kalpena bastayo deyah (10) |

Following the above-mentioned procedure, enema is given with the meat of the following categories of animals and birds:
Mrga (animals inhabiting dry land/forests)
Viskira (gallinaceous birds)
Anupa (animals inhabiting marshy land) and
Bilesaya (animals living in the burrows in earth) [18 (10)]

Madhvadya Yapana Basti

??? ??? ????????????????????????? ?????????????? ???????????????????? ??????????????? ??????????????????????? (??) |
madhu ghrta dviprasrtastulyosnodakah satapuspardhapalah saindhavardhaksayukto bastirvrsyatamo mutrakrcchrapittavataharah (11) |

Two Prasrtas of madhu (honey) and Ghrta (ghee) is added with two Prasrtas of warm water. To this, half pala [of the paste] of Shatapuspa and half aksa of rock salt should be added. It cures mutrakrccha (dysuria) and diseases caused by pitta as well as vayu. [18 (11)]

Sadyo Ghrtadya Yapana Basti

???????? ??? ??? ???? ???????????? ??????????? ???????????????????? ??????????????? ???????????? ?????????????? ?????? (??)|
sadyoghrta taila vasa majja catusprastham hapusardhapalam saindhavardhaksayukto bastirvrsyatamo mutrakrcchra pittavyadhiharo rasayanah (12)|

Four Prasthas of freshly collected ghee, oil, vasa (muscle fat) and Majja (bone-marrow) is added with [the paste of] half pala Hapusa, and half aksa of rock-salt and used for enema
This enema is exceedingly aphrodisiac. It cures Mutrakrcchra (dysuria) and diseases caused by pitta. It rejuvenates the body. [18 (12)]

Madhutailadya Yapana basti

??????? ??????????? ?????????????? ???????????????????? ???????????? ?????? ????????? ?????????? ???????? ?????? ?????? ???????????? ?????????? ?????? ????? ?????? (??) |
madhutailam catuhprasrtam satapuspardhapalam saindhavardhaksayukto bastirdipano brmhano balavarnakaro nirupadravo vrsyatamo rasayanah krimi kusthodavarta gulmarso bradhna pliha mehaharah (13) |

Four prastas of madhu (honey) and taila (oil) are added with [the paste of] half pala of Shatapuspa, and half aksa of rock-salt.
Enema with this recipe produces the following effects:
Stimulates the power of digestion (dipana)
Nourishes the body (Brmhana)
Promotes strength and complexion (bala-varnakara)
Produces no harmful effects (nirupadrava)
Promotes virility exceedingly (Vrsyatama)
Rejuvenates the body (Rasayana)
Cures krimi (parasitic infestation), Kustha, Udavarta, Gulma, Arsas, Bradhna (inguinal swelling), Phiha (splenic disorder) and Meha [18 (13)]

Madhughrtadya Yapana basti First Recipe

?????????????????? ?????????? ?????? ??????????? ????????? ???????? ?????????? ????? ????? ??? ?????????? ???????????? ?????????????? ???????? (??) |
tadvanmadhughrtabhyam payastulyo bastih purvakalkena balavarnakaro vrsyatamo nirupadravo basti medhra paka parikartika mutrakrcchra pittavyadhiharo rasayanasca (14) |

Similarly, Madhu (honey) and Ghrta (ghee) added with equal quantity of milk is mixed with the paste of drugs described above (in recipe no. 23)
Enema with this recipe has the following effects:
It promotes strength and complexion (Bala-Varnakara)
It produces aphrodisiac effects (Vrshyatama)
It causes no adverse effects (Nirupadrava)
It cures inflammation of urinary bladder and phallus (basti-medhra-paka), sawing pain (Parikaritika), dysuria (mutra-krcchra) and diseases caused by Pitta and
It rejuvenates the body (Rasayana) [18 (14)]

Madhu-Ghrtadya Yapana Basti - Second Recipe

?????????????????? ???????????? ???????????????
?????????????????? ???? ??????? ????? ?????????????????????? ????? ???? ????? ????? ??????????? (??) |
tadvanmadhughrtabhyam mamsarasatulyo mustaksayuktah
purvavadbastirvata balasa padaharsa gulma trikorujanurunikuncana basti vrsana medhra trika prsthasulaharah (15) |

Similarly, honey (Madhu) and ghee (ghrta) is added with equal quantity of meat-soup and [the paste of] one aksa of Musta. This enema recipe prepared according to earlier procedure (recipe no.23) cures vata-balasa (an ailment caused by aggravated vayu and kapha), padaharsa (tingling sensation in the feet), gulma (phantom tumour), contraction (stiffness) of lumbar region, thighs and knee-joints, and pain in the region of the urinary bladder, scrotum, phallus, lumbar region and back. [18 (15)]

Suradya Yapana Basti

???? ?????? ?????? ?????? ??? ??? ??? ??????????? ????? ??????? ??????? ????? ?????? ????????????? (??) |
sura sauviraka kulattha mamsarasa madhu ghrta taila saptaprasrto musta satahva kalkitah salavano bastih sarvavatarogaharah (16) |

Seven Prasrtas of Sura (a type of alcohol), Sauviraka (vinegar), Kulattha-soup, meat-soup, honey, ghee and oil is added with the paste of Musta and Shatahva. This recipe added with salt may be used for enema which cures all the vatika diseases. [18 (16)]

Dvi Panchamuladya Yapana Basti

??????????? ??????? ????? ????? ????? ??????? ?????? ???? ????? ????? ???? ??????? ???????????? ??????? ????????? ?????? ??????? ?????? ?????????? ???????????? ??????????????? ?????????????? ??? ???||??||
dvipancamula triphala bilva madanaphala kasayo gomutra siddhah kutaja madanaphala musta patha kalkitah saindhavayavasuka ksaudra tailayukto bastih slesma vyadhi bastyatopa vatasukrasanga pandurogajirna visucikalasakesu deya iti||18||

Two types of Panchamula (roots of Bilva, Shyonaka, Gambhari, Patala, Ganikarika, Shalaparni, Prsniparni, Brhati, Kantakari and Gokshura), Triphala, Bilva (fruit) and Madanaphala is boiled by adding cow's urine. To this decoction, the paste of Kutaja, Madanaphala, Musta and Patha is added. By adding rock-salt, yava-ksara (an alkali preparation of barley), honey and oil, this is used for enema.
This enema is used for treatment of diseases caused by Kapha, Bastyatopa (flatulence in the region of the urinary bladder), retention of flatus and semen, anaemia, indigestion, visucika (choleric diarrhoea) and alasaka (intestinal torpor). [18]

Recipes of Anuvasana Basti

Shatavaryadi Sneha Basti

?? ??????? ?????????? ???????? ?????????|
?????? ????????????????????? ???????? ?????????? ??????????????? ????????? ????????? ????????? ??? ?? ????????????????? ???? ???? ???????, ????????? ???? ??????? ??????????? ???????? ??????? ?????????? ??????? ????????? ???????? ??????????- ???????? ??????????? ?????????????????????????????????????????????????????????????????????????????? ??????? ??????? ???????|
?????? ??? ???? ??????? ??????? ?????? ?????????????????? ???????????????????????? ???????????????, ?? ?????? ??????????????? ????????? ???????????????????????? ??????|
????? ??????????????? ?????????? ????????? ???????????????? ??????????????? ?????????? ??????????????? ?????????????????????? ? ????????? ?????????????????? ??????? ???????????? ???????????? ???????? (?)|??|
ata urdhvam vrsyataman snehan vaksyamah|
satavari guduciksuvidaryamalaka draksa kharjuranam yantrapiditanam rasaprastham prthagekaikam tadvadghrta taila go mahisyajaksiranam dvau dvau dadyat, jivakarsabhaka meda mahameda tvakksiri srngataka madhulika madhukoccata pippali puskarabija nilotpala kadambapuspa- pundarika kesarakalkan prsatataraksumamsakukkutacatakacakoramattaksabarhijivanjivakulingahamsandarasavasamajjadesca prastham dattva sadhayet|
brahma ghosa sankha patahabheri ninadaih siddham sitacchatrakrtacchayam gajaskandhamaropayedbhagavantam vrsadhvajamabhipujya, tam sneham tribhagamaksikam mangalasih stutidevatarcanairbastim gamayet|
nrnam striviharinam nastaretasam ksataksina visamajvarartanam vyapannayoninam vandhyanam raktagulmininam mrtapatyanamanartavanam ca strinam ksinamamsarudhiranam pathyatamam rasayanamuttamam valipalitanasanam vidyat (1)|19|

Now we shall describe Snehana recipes having excellent aphrodisiac effects.
One Prastha each of the juice of Shatavari, Guduchi, Iksu, Vidari, Amalaki, Draksha and Kharjura is taken out separately with the help of instruments (mechanically). To this, two Prasthas each of ghee, oil, cow's milk, buffalo-milk and goat-milk is added. This should then be added with the paste of Jivaka, Rsabhaka, Meda, Mahameda, Tvak-Ksiri (vamsalocana), Srngataka, Madhulika, Madhuka, Uccata, and Pippali, seeds of Pushkara, Nilotpala, and flower of kadamba, pundarika and Kesara. The recipe is cooked by adding one prastha of the meat-soup of Prasta and Taraksu, and the sap of the eggs of Kukkuta, Cakora, Mattaksa (kokila), Barhi, Jivajivaka, Kulinga and Hamsa, vasa (muscle-fat), Majja (bone-marrow) etc.
After having worshipped Lord Siva, this cooked Sneha (medicated fat) is placed on the back of an elephant with a white umbrella held over it. While chanting Vedic mantras and blowing conch-shell accompanied with the beating sound of Pataha (hand- drum) as well as Bheri (kettle Drum).
To this medicated fat, honey one-third in quantity thereof is added. With auspicious benedictions, prayers and worshipping of the Gods, this recipe is administered as enema.
This enema-recipe is exceedingly wholesome for the following:
Persons indulging in sexual act in excess
Persons suffering from loss of semen
Patients suffering from Kshata-Ksina (Phthisis) and Vishama-Jvara (irregular fever)
Women suffering from gynecological disorders, sterility and rakta-gulma (uterine tumour)
Women whose offspring succumb to death before or after delivery
Women suffering from amenorrhoea and
Persons having diminished muscle-tissue and blood
It is excellent Rasayana (rejuvenating therapy), and it cures the appearance of wrinkles on the skin (vali) and graying of hair (Palita). [19 (1)]

Baladya Sneha basti

??? ???????? ?????????????? ?????? ???????? ??? ????????? ?????????? ?????????, ??????? ?? ??????????? ??? ?????????? ??????????? ????????????? ???? ???? ??? ??????? ????? ??? ????????????????????? ??? ????????????? ??????????? ????????? ???????? ??????? ????? ???? ??????? ??????????? ???????? ???????? ????????????????????? ??? ????? ?????? ??????????????- ???????? ????????? ?????????? ?????? ?????? ???? ??????? ??????? ????????? ????????? ??????? ???????|
?????????????? ?????? ?????? ?????? ???????|
??? ????????? ???????; ? ?????????? ????????? ???????? ??????|
?? ?????? ????? ????? ??????? ??? ???????? ????????? ????????? ???????????????? ??????????????? ? ??????? (?)|??|
bala goksuraka rasnasvagandha satavari sahacaranam satam satamapothya jaladronasate prasadhyam, tasmin jala dronavasese rase vastrapute vidaryamalaka svarasayorbasta mahisa varaha vrsa kukkuta barhi hamsa karandavasarasandarasanam ghrta tailayoscaikaikam prasthamastau prasthan ksirasya dattva candana madhuka madhulika tvakksiri bisamrnala nilotpala patolatmaguptannapaki tala mastaka kharjura mrdvikatamalaki- kantakari jivakarsabhaka ksudrasaha mahasaha satavari meda pippali hribera tvakpatra kalkamsca dattva sadhayet|
brahmaghosadina vidhina siddham bastim dadyat|
tena strisatam gacchet; na catraste viharahara yantrana kacit|
esa vrsyo balyo brmhana ayusyo vali palitanut ksataksina nastasukra visamajvarartanam vyapannayoninam ca pathyatamah (2)|19|

One hundred Palas of each of bala, Gokshuraka, Rasna, Ashwagandha, Shatavari and Sahacara is crushed into small pieces and boiled by adding remains. This liquid should then be filtered out by a cloth. This is cooked by adding the following ingredients:
One Prastha (768 g) each of the juice of Vidari and Amalaki
One Prastha each of the meat-soup of goat, buffalo, pig and bull
One Prastha each of saps of the eggs of domestic fowl, pea-hen, swan, Karandava and Sarasa
One prastha each of ghee and oil
Eight Prasthas of milk and
Paste of Chandana, Madaka, madhulika, Tvak-Ksiri (vamsa- locana), Bisa-Mrnala, Nilotpala, Patola, Atmagupta, Anna-Paki, (Odana- Paki), tala-mastaka, Kharjura, Mrdvika, Tamalak, Kantakari, Jivaka, Rsabhaka, Ksudrasaha (mudgaparni), mahasaha (Mashaparni), Shatavari, Meda, Pippali, Hribera, Tvak and Patra.
Following the procedure of the recitation of Vedic mantras and such other rituals described earlier (in respect of recipe no.27), enema with this recipe is given.
By this enema a person becomes capable of having sexual intercourse with many (lit. Hundred) women). This enema does not involve any restriction of diet or regimen on the part of the patient. It promotes virility, strength, corpulence and longevity. It cures wrinkles (vali) on the skin and graying of hairs (palita). It is exceedingly wholesome for patients suffering from phthisis, loss of semen, Vishama-Jvara (irregular fever) and Gynecic disorders. [19(2)]

Sahacharadya Sneha Basti

???? ?? ?????? ????? ????????? ??????? ????????? ??? ?????? ???????????? ???????????????????????? ??? ??? ??????? ??? ???? ???? ????? ??????? ?????? ???? ??????? ?????? ??????????? ?????????? ????????? ?????????- ??? ???? ??????????? ?????? ?????????????????????????????????? ?????? ???????|
???????????? ?????? ?????? ?????? ???????|
?? ?????????? ?????? ???????? ????????????????????????? ???? ???? ??? ????? ????? ????? ??? ??????????????????? ??? ???????????? ??? ?? ???? ????? ?????? (?)||
sahacara pala satamudaka drona catustye paktva dronasese rase supute vidariksurasa prasthabhyamastagunaksiram ghrta taila prastham bala madhuka madhuka candana madhulika sariva meda mahameda kakoli ksirakakoli payasyaguru manjistha vyaghranakha- sati sahacara sahasravirya varanga lodhranamaksamatrairdvigunasarkaraih kalkaih sadhayet|
bahmaghosadina vidhina siddham bastim dadyat|
esa sarvarogaharo rasayano lalitanam srestho'ntahpuracarininam ksata ksaya vata pitta vedana svasa kasa harastribhagamaksiko vali palitanudvarna rupa bala mamsa sukra vardhanah (3)||

One hundred Palas (4.8 kg) of Sahacara is added with four Dronas of water, and cooked till one drona of the liquid remains. This decoction should then be strained out, and cooked by adding the following Ingredients:
One Prastha each of the juice of vidari and sugarcane
Sixteen Prasthas of milk
One Prastha each of ghee and oil
Paste of one Aksa each of Bala, madhuka, Madhuka, Chandana, Madhulika, Sariva, Meda, Mahameda, kakoli, Ksirakakoli, Payasya, Aguru, Manjistha, Vyaghranakha, Salt, Sahacara, Sahasravirya, (durva), Varanga (Guda- Tvak) and Lodhra, and two Aksas, of sugar.
This recipe is administered as enema while reciting Vedic Mantras and performing other sacred rituals. This enema has the following effects:
It is a panacea for all diseases
It rejuvenates the body
It is the best therapy for delicate women living in harems
It cures Kshata-Ksina (Phthisis), pain caused by Vayu and Pitta, Asthma, and cough and
When used by adding honey, one third in quantity of the recipe, it cures wrinkles (vali), graying of hair (palita) and promotes colour, complexion, beauty strength, muscle tissues and semen. [19 (3)]

Augmenting Potency of Basti Recipes

??????? ??????? ????? ?????? ??? ????? ??????? ????????? ?? ?????? ???????????????????||??||
ityete rasayanah sneha bastayah sati vibhave satapakah sahasrapaka va karya viryabaladhanarthamiti||19||

If the patient is affluent enough, then the above-mentioned rejuvenating Sneha-Bastis (unctuous enema) is prepared by cooking for the hundred times (Shata-paka) or one thousand times (Sahasra-paka) for promotion of their potency and strength. [19]

Recapitulation

?????? ?????-
??????? ?????? ?????????????? ??????????????|
?????????????????? ? ????????? ???????????||??||
???????????????? ?????????????????|
??????????????? ????????????? ???????||??||
????????????????? ?????? ????????????|
?????????? ??????? ??????????????????||??||
bhavanti catra-
ityete bastayah snehascokta yapanasanjnitah|
svasthanamaturanam ca vrddhanam cavirodhinah||20||
ativyavayasilanam sukramamsabalapradah|
sarvarogaprasamanah sarvesvrtusu yaugikah||21||
narinamaprajatanam naranam capyapatyadah|
ubhayarthakara drstah snehabastiniruhayoh||22||

The above-mentioned Sneha Basti recipes are called Yapana Bastis. These are not contra-indicated either for healthy persons or for patients or for old persons. They promote semen and muscular tissue of persons, excessively indulging in sex. These are panaceas for all diseases, and are suitable for administration in all the seasons. These recipes are suitable for both, Sneha-basti (unctuous enema) and Niruha- Basti (evacuative enema). [20-22]

Prohibitions

???????? ?????? ????? ????? ?????????? ?|
???????? ???????? ????????????? ????????||??||
vyayamo maithunam madyam madhuni sisirambu ca|
sambhojanam rathaksobho bastisvetesu garhitam||23||

While using the above mentioned Yapana Bastis, the patient should avoid physical exercise, sexual intercourse, intake of alcohol, intake of different types of honey and cold water, eating full meal and jolting by conveyances. [23]

Summary

???? ??????? -
???????????????????????????????????????| ?????????????????????????????????? ??????????||??||
????????? ??? ?????????????????????????| ?? ???????????????? ?????????? ??????||??||
?? ?????????????? ??????????? ??????| ????? ?????????????????????????????? ||??||
?????????????????????????? ???????| ?????????????????? ?? ??????? ??????||??||
???????? ???????? ?????? ???? ??? ??????????|
tatra slokah -
sikhigonardahamsandairdaksavadbastayastrayah| vimsatirviskiraistrimsatpratudaih prasahairnava||24||
vimsatisca tatha saptavimsatiscambucaribhih| nava matsyadibhiscaiva sikhikalpena bastayah||25||
dasa karkatakadyaisca kurmakalkena bastayah| mrgaih saptadasaikonavimsatirviskirairdasa ||26||
anupairdaksasikhivadbhusayaisca caturdasa| ekonatrimsadityete saha snehaih samasatah||27||
prokta vistaraso bhinna dve sate sodasottare|

Thus, in brief, twenty-nine Yapana-Bastis including three sneha bastis are described above. In addition, the following extended categories of enema recipes are also described.
(1) to (3) three Bastis with the eggs of Sikhi (Peahen), Gonarda (bird Indian crane) and Hamsa (swan) which are to be prepared in the same way like the method described for the egg of hen in para no. 16(12). [Vide para no. 17]
(4) to (118) twenty recipes with the meat of Viskiras (gallinaceous birds), thirty recipes with Pratudas (pecker birds), 29 recipes with Prasthas (animals who eat by snatching food), 27 recipes with aquatic animals, and nine recipes with fish, etc., which are to be prepared on the line suggested for the enema recipe with the meat of peacock in para 18 (3). [Vide para no. 18 (4)
(119) to (128) ten recipes with the meat of Karkata, etc. which are to be prepared on the line suggested for Kurma in Para no. 18(6)
(129) to (187) seventeen recipes with the meat of mrgas (animals dwelling in dry land forests), nineteen recipes with the meat of Viskiras (gallinaceous birds), nine recipes with the meat of anupas (marshy land inhabiting animals), and fourteen recipes with bhusayas (animals living in burrows on the earth) which are to be prepared on line suggested for the recipes of domestic fowl and peacock in para no 18(9). [Vide para no.18 (10)]
Thus, when classified in detail, the 29 original recipes and 187 extended recipes make for 216 recipes in total. [24- 27 1/2 ]

Augmenting potency of recipes

??? ???????????????? ???????????????? ????||??||
???????? ? ??????? ????????????? ? ???????|??|
ete maksikasamyuktah kurvantyativrsam naram||28||
natiyogam na va'yogam stambhitaste ca kurvate|29|

Use of above-mentioned enema recipes by adding honey makes a person exceedingly virile. When fortified (with honey), they do not allow any over action (atiyoga) or under action (ayoga). [28 1/2 - 1/2 29]

Management of non-eliminated recipes

??????????? ?????????? ???? ?????? ??????????||??||
???????????????????????????????????? ?????????? ??|??|
mrdutvanna nivartante yasya tvete prayojitah||29||
samutrairbastibhistiksnairasthapyah ksiprameva sah|30|

If, because of mild nature, the administered enema recipes described above do not get eliminated, then immediately Asthapana-Basti (evacuative enema) containing cow's urine and other sharp ingredients is given. [29 1/2 - 1/2 30]

Adverse effects of excessive use of Yapana basti, and their management

??????????? ????????? ???????????????????||??||
?????????????????????? ??????????????????|??|
????????????????????? ????????? ????? ??????||??||
???????? ?????????????? ???????? ?????????|
sophagninasa pandutva sularsahparikartikah||30||
syurjvarascatisarasca yapanatyarthasevanat|31|
aristaksirasidhvadya tatresta dipani kriya||31||
yuktya tasmanniseveta yapananna prasangatah|

Excessive use of these Yapana-Bastis gives rise to oedema, loss of the power of digestion, anemia, colic pain, piles, parikartika (sawing pain), fever and diarrhea.
For the treatment of these ailments, the patient is given aristas (medicated wines), milk, sidhu (a type of alcohol) etc. and therapies for the promotion of digestion.
Therefore, Yapana-Basti is used judiciously and should not be used continuously (as a matter of habit). [30 1/2 - 1/2 32]

Impediments and their management

????????????????????????? ??????? ????????????||??||
???????? ????? ???????????????? ?????????? ???|??|
ityuccairbhasyapurvanam vyapadah sacikitsitah||32||
vistarena prthak proktastebhyo raksennaram sada|33|

Different factors (e.g., loud speech) which cause impediments and their management are separately described earlier in detail (in verse/para nos. 10-15).
The patient should always be guarded against these impeding factors. [32 1/2 - 1/2 33]

Definition of Siddhi- Sthana

??????? ????????????????????????||??||
????????? ????? ?????? ???????????? ????????|??|
karmanam vamanadinamasamyakkaranapadam||33||
yatroktam sadhanam sthane siddhisthanam taducyate|34|

The section (sthana) describing the successful (siddhi) administration of elimination therapy (emesis, etc.) the complications arising out of their mal-administration, and management of these complications is called Siddhi-Sthana". [33 1/2 - 1/2 34]

Merits achieved by study

???????????? ???????????????????????||??||
???????? ????????? ????????????????? ?????|??|
?????????????? ?????????? ????????? ???? ????????||??||
??????? ?????????? ???? ?????????? ?????? ????|??|
ityadhyayasatam vimsamatreyamunivanmayam||34||
hitartham praninam proktamagnivesena dhimata|35|
dirghamayuryasah svasthyam trivargam capi puskalam||35||
siddhim canuttamam loke prapnoti vidhina pathan|36|

Thus, this treatise comprising one hundred and twenty chapters which expound the statements of the sage Atreya was propounded by Agnivesha, endowed with therapeutic wisdom for the benefit of all the living beings.
The systematic study of this treatise endows a person with longevity, fame, health, abundance, fulfilment of the three basic desires of life and unsurpassable professional accomplishment in this world. [34 1/2 - 1/2 36]

Pratisamskarta or Redactor

?????????? ???????? ?????????????????????||??||
????????? ?????? ??????? ?????? ? ?????????| ??????????????????? ????????????????||??||
???????? ??????????????? ???????????????????|
vistarayati lesoktam sanksipatyativistaram||36||
samskarta kurute tantram puranam ca punarnavam| atastantrottamamidam carakenatibuddhina||37||
samskrtam tattvasampurnam tribhagenopalaksyate|

A redactor expands the concised statements and abbreviates the very prolix ones in an old work, and thus, puts it in a new (revised) form.
Therefore, Charaka, possessed with excellent wisdom redacted this illustrious treatise, which however, is incomplete in as much as (almost) one-third of this redacted text was missing (not available at the time of Drdhabala). [36 1/2 - 1/2 38]

Dridhabala and his supplementations

????????? ??????? ??????????? ???????||??||
?????????? ?????? ???? ??????? ????| ?????? ??????????????????? ???????????????????||??||
?????????????????????????????????| ????????????????? ???????????????????||??||
????????? ?????????????????? ???????????????|??|
tacchankaram bhutapatim samprasadya samapayat||38||
akhandartham drdhabalo jatah pancanade pure| krtva bahubhyastantrebhyo visesonchasiloccayam||39||
saptadasausadhadhyayasiddhikalpairapurayat| idamanyunasabdartham tantradosavivarjitam||40||
sadvimsata vicitrabhirbhusitam tantrayuktibhih|41|

Drdhabala, born in Panchanadapura (present Punjab) supplemented these (non- available) chapters after propitiating God Shiva, the protector of all creatures, to make the work complete.
By culling matter from several important treatises, he compiled and restored 17 chapters of Cikitsa-sthana and all the chapters of Siddhi as well as kapla-sthanas.
This text is not deficient in words (shabda) or their implications (artha) concerning medical science, and it is decorated with 2 relevant Tantra-yuktis (canons of scientific exposition). [38 1/2 - 1/2 41]

Tantra Yuktis (Canons of Expositions)

??????????? ???? ?????????????? ????? ?||??||
????????????????????????????? ?????????| ??????????????????????????????????||??||
?????????????????????? ???????? ????????| ??????????????????????????????????||??||
??????????????????????????????????????| ???????? ???????? ????????? ?????????||??||
??????????????????????? ????????????????????|??|
tatradhikaranam yogo hetvartho'rthah padasya ca||41||
pradesoddesanirdesavakyasesah prayojanam| upadesapadesatidesarthapattinirnayah||42||
prasangaikantanaikantah sapavargo viparyayah| purvapaksavidhananumatavyakhyanasamsayah||43||
atitanagataveksasvasanjnohyasamuccayah| nidarsanam nirvacanam sanniyogo vikalpanam||44||
pratyutsarastathoddharah sambhavastantrayuktayah|45|

Tantra-Yuktis or canons of compositions are as follows:
Adhikarana or subject matter: (the central theme the author intends to expound in a treatise while the author composes a treatise) For example, in Sutra 1:7, it is stated that this Ayurvedic treatise is presented in order to prevent and cure diseases which are impediment to the path of an individual willing to perform righteous tasks on the context of duties. Here the diseases, the treatise, etc., constitute the Adhikarana or the central theme).
Yoga or union: Justifying a statement by putting together different words in order to explain the point from various angles. For example - origin of the embryo from maternal factors etc., has been explained on the basis of logical terms like Pratijna, Hetu, Udaharana, Upanaya and Nigamana in Sarira 3: 10-114)
Hetvartha or extension of Argument: When a statement is made in a particular context that is applicable to other situations as well it is called as hetvartha. For example, in Sutra 12: 5, habitual intake of homologous matter is stated to increase dhatus. The term "dhatu" in this context implies doshas as well besides tissue elements. The statement made here is in the context of Vayu Dosa. The same Principle is applicable to other situations like the augmentation of the quantity of Rasa, etc.
Padartha or implication of words: One, two or many words individually or jointly may carry specific (technical) meanings. For example, the term "Dravya" stands for five Mahabhutas and Atman, and the two terms "Ayusah Vedah" (science of life) stands for the treatise on Ayurveda)
Pradesha or partial enunciation: When there are many objectives of a topic and all of these cannot be explained in one place, then in a given situation, only a partial statement is made [in the form of a sample]. For example, in Sutra 27:329 while explaining the properties of various types of Anupanas, they in their entirety cannot be explained, and only a part of these, including some of the commonly used ones are described).
Uddesha or concise statement: Making a concise statement having wider implications. For example, the scope of Ayurveda is described in Sutra 1: 24 as hetu, linga, usadhi jnanam, i.e the knowledge of the etiology, signs and symptoms and medicines i.e., treatment or management of healthy persons and patients)
Nirdesha or amplification: The above-mentioned concise statement has been implied later. The explanation of Hetu linga usadhi jnana is provided later in Sutra 1: 44- 53)
Vakya Sesha or supply of ellipsis: Sometimes, in order to make the statement lighter or smaller in size, certain parts of it are omitted, and this ellipsis has to be inferred with reference to the context. For example, in the statement "pravrttihetun Bhuvanam" (vide Sutra 16: 28), the verb "Asti" has to be inferred though it is not specifically mentioned in the text. Without this verb the sentence is incomplete. Similarly, while describing the soup (rasa) of the meat (mamsa) of animals inhabiting dry land forests (jangala), only Jangalajaih Rasaih is mentioned (vide Siddhi 1:9). In this statement, the term "Mamsa" has to inserted to make the meaning complete. Since it is not mentioned in the text, it has to be inferred.
Prayojana or object: It is the purpose for which a treatise is composed. For example, the purpose of composing Charaka Samhita is to provide information regarding measures to be adopted for achieving equilibrium of Doshas and Dhatus (vide Sutra 1:53)
Upadesa or Authoritative instruction: The preceptor's instructions are included in a treatise. For example, first of all oleation (sneha) therapy is administered, and only thereafter, fomentation (Sveda) therapy is given to the patient (vide Sutra 13: 99)
Apadesha or reasoning a statement: When a statement is made, the reason for making such a statement is provided, for example, among the pollutions of vayu (air), jala (water), Desa (land) and kala (time), the latter ones are more serious than the former ones because the latter ones are more unavoidable (vide Vimana 3:10) this unavoidability (duspariharyatva) is the reason for making the statement.
Atidesha or indication: A specific statement might indicate non- specified objects. For example, in Sutra 9: 34, it is stated. "The regimens not specified in this chapter are also to be adopted if these are wholesome".
Arthapatti or implication: Statement may imply an unspecified object. For example, it is stated in Sutra 7:61, "one should not take curd at night". By implication, curd can be taken during the day time.
Nirnaya or decision: The conclusion drawn after proper examination. For example, it is stated in sutra 10:3, "Sixteen aspects of treatment, four each relating to the physician, drug, attendant and patient, described earlier are sine Qua non for good health provided these are applied appropriately". This proper application (yukti-yukta) represents the decision (Nirnaya) after proper examination)
Prasanga or restatement: Statement made earlier is repeated in view of context. For example, the statement regarding the wrong utilization, etc., of senses made in Sutra11: 37 is repeated in sutra1: 118: 126 because of contextual propriety.
Ekanta or Categorical statement: A statement made for explaining another view-point without upholding it. For example, the death of pressers for want of medicines, it is stated that even the diseases of these persons are not (always) amenable to therapeutic measures- vide Sutra 10: 5)
Apavarga or exception: A statement made regarding exceptions to general rules. For example, as a general rule intake of stale food is prohibited. But in case of meat etc., the stale (dried) ones are not prohibited. In fact, as exceptions to the general rule, these are permitted (vide Sutra 8:20)
Viparyaya or reconfirmation of implied opposite action: A statement made to reconfirm the implied meaning. For example, it is stated that the factors responsible for the causation of the diseases are not wholesome for the patient. By implication, factors having opposite attributes are wholesome for the patient. But this is reconfirmed in another statement made subsequently- vide Nidana 3:7)
Purva-Paksa or amplification of earlier statements: Sometimes a statement in general made earlier is partially modified. For example, having stated that all types of fish are not be taken with milk, the statement is amplified by the statement that cilicima type of fish especially should not be taken with milk- vide Sutra 26: 84)
Vidhana or correct interpretation: Sometimes a statement made earlier is further explained in order to bring out its correct implications.
According to some, this term "Vidhana" means description in correct order. For example, tissue elements are described in their appropriate sequence, rasa, rakta etc. Vide Chikitsa 15: 16)
Anumata or Confession: Non-contradiction, a different view. For example, the author has quoted another view regarding the method to be followed for the extraction of the dead foetus, and has not contradicted it. By implication, the author has accepted it Vide sarira 8: 31)
Vyakhyana or explanation: Explaining a topic to make it comprehensible by people having different intellectual quotients. For example, the condition of the foetus during the first month of pregnancy is described in detail- vide Sarira 4: 9)
Samsaya or doubt: Description of different view-points on a selected topic leaving the concluding uncertain. For example, the cause of procreation is described differently by various authors as mother (ovum), father (sperm), Svabhava (nature), Paranirmana (supernatural force) or Yaddrccha (accidental, not predetermined) vide Sutra 11: 6)
Atitaveksana or retrospective reference: Sometimes, the text refers to the description of a given topic made earlier. For example, while describing the treatment of Jvara (fever), a reference is made to the fomentation therapy details of which were described earlier - Chikitsa 3: 29)
Anagataveksana or prospective reference: Sometimes while describing a topic, a reference is made to a recipe which is to be described later. For example, while describing the treatment of fever, Tikta-Sarpis is described to be used. Details of this recipe are however described later)
Svasanjna or use of technical terms: Sometimes, the author uses certain technical terms which are generally not found elsewhere. For example, Jentaka, Holaka etc., Vide Sutra 14: 39:40)
Uhya or deduction: Sometimes, regarding a statement made in the text, the physician is advised to use his own power of discretion. For example, while describing ingredients of a recipe, the physician is advised to ignore the inappropriate ones according to his own desecration depending on as specific situation- vide Vimana 8: 149)
Samuccaya or specification: Sometimes, the term "Ca", is used repeatedly after each item which imply all these items are to be taken together. For example, the term "Ca" is used after Varna (complexion), Svara (voice) etc., in Indriya 1:3 to emphasise that all these items are to be considered together to determine the span of life of a person.
Nidarsana or illustration: Sometimes, a topic is illustrated with similes in order to make it understandable by intelligent and non-intelligent people alike. For example, it is stated that the use of a drug with which the physician is well acquainted works like ambrosia - vide Sutra 1:124)
Nirvachana or citation of analogy: Sometimes, an example is given in order to facilitate easy comprehension of a topic for the annihilation of beings which cannot be comprehended because such factors are unpredictable. This is based on the analogy of time. Time is always in the process of quick movement. It automatically goes on changing or destroying itself - Sutra 16: 32.
Nidarsana (item no. 30) facilitates comprehension of a topic by both intelligent and non-intelligent physicians whereas Nirvachana is exclusively for intelligent physicians.
The term "Nirvachana" can also be explained as a definition. For example, the disease "Visarpa" is defined as the ailment which moves (sarpati) in different direction (Vividha) vide Chikitsa 21:11)
Sanniyoga or injunction: Chakrapani has used the word "Niyoga in the place of Sanniyoga mentioned in the text.
Sometimes a statement is made in order to emphasise absolute necessity. For example, it is stated that the patient (undergoing jentaka therapy) should not leave the bench even if he gets tired owing to excessive heat - vide Sutra 14: 46)
Vikalpa or option
Pratyutsara or rebuttal: Sometimes the author quotes different views, each rebooting the other. For example, Varyovida is stated to hold the view that the diseases are caused by rasa- dhatu, and this view is refuted by Hiranyaksa who holds the view that these are caused by six basic elements, viz, five mahabhutas and the conscious elements - vide Suta 25: 13- 15
Uddhara or reaffirmation: Sometimes the author establishes his own view after refuting another scholar's view. For example, the statement that diseases are caused by the unwholesomeness of such factors, the wholesomeness of which is conducive to procreation- vide Sutra 25:29)
Sambhava or Possibility: Sometimes the place of origin or the infrastructure of manifestation is to be judged from the ailment. For example, the description of Piplu, Vyanga, Nilika etc., implies their location in the face). [41 1/2 - 1/2 45]

Availability of Tantra-Yuktis

??????? ?????????????? ?????????? ?? ?????????||??||
??????? ????????? ??????????? ???|??|
tantre samasavyasokte bhavantyeta hi krtsnasah||45||
ekadesena drsyante samasabhihite tatha|46|

All these Tantra-yuktis or canons of exposition are adopted in their entirety in treatises which are composed in both aphoristic and expository styles. However, in treatises which are composed excessively in aphoristic style, such canons are found only partially. [45 1/2 - 1/2 46]

Importance of Tantra-Yuktis

??????????????????? ??????? ??????? ???||??||
??????????????????????? ????????? ???????|??|
yatha'mbujavanasyarkah pradipo vesmano yatha||46||
prabodhanaprakasarthastatha tantrasya yuktayah|47|

As the sun causes blossoming of the lotus pond (lit forest) and as the lamp enlightens the (dark) house: similarly, the knowledge of these Tantra-Yuktis serves the purpose of awakening (blossoming and enlightening of the physician). [46 1/2 -1/2 47)
Read: Tantra Yukti: Tools For Composing And Understanding Treatises

Assistance of Tantra-Yuktis in understanding other treatises

??????????? ?????? ???????? ?????????? ????||??||
? ?????????????????? ??????????????? ??????????|
?????????? ?????????? ?????????????? ???? ?????|
?????????? ??????????????????? ?????????? ???||??||
ekasminnapi yasyeha sastre labdhaspada matih||47||
sa sastramanyadapyasu yuktijnatvat prabudhyate|
adhiyano'pi sastrani tantrayuktya vina bhisak|
nadhigacchati sastrarthanarthan bhagyaksaye yatha||48||

The physician who has a good grasp even of only one treatise can also understand other treatises quickly because of his proficiency in tantra-yuktis or canons of composition. As a person fails to acquire wealth [in spite of his best efforts] when fortune deserts him, similarly one who is not conversant with tantra-yuktis (canons of exposition) does not understand the real implications of treaties even if he has studied many of them. [47 1/2 - 48]

Proper and improper understanding of treatises

?????????? ??????????? ???????? ???????????????|
???????? ???? ???? ???????? ??????? ? ??????||??||
(?????????? ????????????? ?????????????? ????|
????????????????????? ????????? ????????) ||??||
durgrhitam ksinotyeva sastram sastramivabudham|
sugrhitam tadeva jnam sastram sastram ca raksati||49||
(tasmadetah pravaksyante vistarenottare punah|
tattvajnanarthamasyaiva tantrasya gunadosatah) ||50||

Just like a badly handled weapon destroys the person himself, similarly badly understood treatise causes harm to the user himself. On the other hand, just like a properly handled weapon protects the user from the enemy, similarly the treatise well understood becomes a source of protection against the opponents.
Therefore, to enable the physician to critically analyse the merits and demerits, and comprehend the real implications of statements in this treatise (Ayurveda), these tantra-yuktis or canons of exposition will be explained in detail in the Uttara Tantra or supplementary section of this work. [49-50]

Merits of studying this treatise

???????????? ??????????? ??????? ????????? ????????????|
? ??????????????????? ???? ??????????????????????????||??||
idamakhilamadhitya samyagarthan vimrsati yo'vimanah prayoganityah|
sa manujasukhajivitapradata bhavati dhrtismrtibuddhidharmavrddhah||51||

After studying this text in its entirety with appropriate meaning, the physician who has reflected upon the statements made in it with concentration of mind, who has applied the text constantly in practice, and who has developed the power of reflection, recollection, description and righteousness becomes bestowed of happiness and life (longevity) to human beings. [51]

Epilogue

???? ????????????? ???? ??????? ??????| ?????????? ? ????????????????????????? ??||??||
???????????? ????????? ? ? ??????? ? ???????| ???????? ??????????? ????????????? ?????||??||
????????? ???????? ??????????? ? ??????????| ???????????? ??????? ????????????????||??||
?????????????????? ???????? ??????? ??????? ??| ???????????? ?????????????? ?????? ????????) ||??||
yasya dvadasasahasri hrdi tisthati samhita| so'rthajnah sa vicarajnascikitsakusalasca sah||52||
rogamstesam cikitsam ca sa kimartham na budhyate| cikitsa vahnivesasya susthaturahitam prati||53||
yadihasti tadanyatra yannehasti na tatkvacit| agnivesakrte tantre carakapratisamskrte||54||
siddhisthane'stame prapte tasmin drdhabalena tu| siddhisthanam svasiddhyartham samasena samapitam) ||55||

The physician who has in his memory this treatise containing twelve thousand (verses and prose paragraphs] is definitely the knower of its implications. He has the power of discrimination and he is proficient in the treatment of diseases. Such a person cannot fail to diagnose and initiate its [appropriate] treatment.
The therapeutic measures described in Agnivesa's work are useful both for healthy persons [to maintain their positive health and prevent occurrence of diseases] and patients [to cure found elsewhere.
The treatise of Agnivesha as redacted by Charaka has reached up to its [final] eighth section called Siddhi-sthana. For the accomplishment of this Siddhi-sthana, the final touch in brief is given by Drdhabala. [52- 55]

Colophon

??????????????? ??????? ????????????????????????? ?????????????? ???????????? ????????????????????? ??????????????||??||
??? ???????????? ?????? ???????????? ??????????|
????????? ?????????|
ityagnivesakrte tantre carakapratisamskrte'prapte drdhabalasampurite siddhisthane uttarabastisiddhirnama dvadaso'dhyayah||12||
iti carakasamhitayam astamam siddhisthanam sampurnam|
samapteyam carakasamhita|

Thus, ends the twenty chapter of Siddhi- section dealing with "Measures to Attain Perfection in the administration of Uttara- Basti (important recipes of Enema)" in Agnivesha 's work as redacted by Charaka, and Because of its non- availability, supplemented by Drdhabala.
Thus ends Charaka Samhita.

Share this:

Related